top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|5648969|5653050|-|3|circRNA|ASB13|NM_024701|4,3,2

ASB13

Open Reading Frame (ORF)

LTSGPIWKRTIAILGPLCTLPVPGSIWTVSKCCSMQVSGWSGPLCTRQPSGVRACSCNS

Peptide

RTIAILGPLCTLPVPGSIWTVSK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page