top of page

CircRNA

Gene

chr10|50078692|50084167|+|1|ciRNA|FAM21A|ENST00000434114.6|4

FAM21A

CircRNA UID

ciFAM21A(4)

Open Reading Frame (ORF)

LPQSPLTRKRYHCQRAMPHRGQGSISFSSGGRRLCKGGALS

Peptide

AMPHRGQGSISFSSGGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page