top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|46554695|46556053|—|1|ciRNA|GPRIN2|NM_014696|1

GPRIN2

Open Reading Frame (ORF)

MLPAALPRVGPECSYQAPFTLGWIKPPPGGCCIPTVQWGFVLCAFLPGP

Peptide

MLPAALPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page