top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|45752587|45765810|+|8|circRNA|FAM21C|ENST00000359860.7|11,12,13,14,15,16,17,18

FAM21C

Open Reading Frame (ORF)

LSLQAQREEKAKASELSKKKASALLFSSDEEMKRITYSHPPS

Peptide

ASALLFSSDEEMKR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page