top of page

CircRNA

Gene

chr10|45533109|45533289|-|1|circRNA|MARCH8|ENST00000453424.6|2

44993

CircRNA UID

circ45359(2)

Open Reading Frame (ORF)

MTLPVETLFCEEDDQIRGWDEHATASDLCHSIPGCHLC

Peptide

MTLPVETLFCEEDDQIRGWDEHATASDLCHSIPGCHLC

ORF Found in Long-Read

false

Peptide Length

38

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

38

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page