top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|45459119|45461411|—|2|circRNA|MARCH8|ENST00000453424.6|7,6

44993

Open Reading Frame (ORF)

LQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGSATVKEMMRAP

Peptide

QGQATGSATVK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page