top of page

CircRNA

Gene

chr10|408925|423033|-|5|circRNA|DIP2C|ENST00000381496.7|8,7,6,5,4

DIP2C

CircRNA UID

circDIP2C(8,7,6,5,4)

Open Reading Frame (ORF)

LWTRSMKVAYSILHKLGTKQEPMVRPGDRIPLLAQKMKAQCRGTPRAPPPPARAASIWSTGSARPSTAPPRPPPPRPLRRAGAAGLPTGWRTSWLRPT

Peptide

GTPRAPPPPAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page