top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|34347955|34360259|—|3|circRNA|PARD3|NM_001184787|15,14,13

PARD3

Open Reading Frame (ORF)

LGAPLDLSCPLKQRWMIENEEFPIPSTVGLRGLMNRPAEMLPSVG

Peptide

QRWMIENEEFPIPSTVGLR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page