top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|33185627|33186491|—|2|circRNA|NRP1|NM_001244972|15,14

NRP1

Open Reading Frame (ORF)

LGPTSAHSGSNCATRSQRSTISWSGWPLDTKVTTGRKGVSCSTSL

Peptide

LGPTSAHSGSNCATR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page