top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|31820386|31831800|—|3|circRNA|ARHGAP12|NM_001270699|8,7,6

ARHGAP12

Open Reading Frame (ORF)

LAVISPNQSSQWTSRGQQLRWLQRINPAKRMYLRIKRNMDY

Peptide

LAVISPNQSSQWTSR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page