top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|31814258|31826385|—|4|circRNA|ARHGAP12|NM_001270699|10,9,8,7

ARHGAP12

Open Reading Frame (ORF)

MIKKRNKRIPKSFVKELVVFLGGVAGFIFTFYQNSRK

Peptide

ELVVFLGGVAGFIFTFYQNSRK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page