top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|27219722|27235212|-|4|circRNA|ACBD5|ENST00000396271.7|6,5,4,3

ACBD5

Open Reading Frame (ORF)

LVMFSLLLQTPKPLMVKLKAVTVEPSLRKKRPKKK

Peptide

AVTVEPSLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page