top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|27043425|27061242|—|8|circRNA|ANKRD26|NM_001256053|20,19,18,17,16,15,14,13

ANKRD26

Open Reading Frame (ORF)

LKQPQRIVSYPTLVTRILCCSLNNLEWSVKMCFIYLLA

Peptide

IVSYPTLVTR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page