top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|24619472|24722279|-|8|circRNA|ARHGAP21|ENST00000396432.6|9,8,7,6,5,4,3,2

ARHGAP21

Open Reading Frame (ORF)

LKALPENLYSLARCLFQQPCPSSEPACGILPLRVCGGIPRHVQCGLQRICPFFVI

Peptide

ALPENLYSLAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page