top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|24596882|24597446|—|1|ciRNA|ARHGAP21|ENST00000396432.6|16

ARHGAP21

Open Reading Frame (ORF)

MLFYFDWQSKGIDVSFLTNKYNDLKLASLRYVYVFCTISTDQAPCQLAQNS

Peptide

GIDVSFLTNKYNDLK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page