top of page

CircRNA

Gene

chr10|21882281|21929141|-|7|circRNA|DNAJC1|ENST00000376980.7|8,7,6,5,4,3,2

DNAJC1

CircRNA UID

circDNAJC1(8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LRNKWMIGWKTGTEHRKNRMHHLQTSEKHIVSFH

Peptide

WMIGWKTGTEHR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page