top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|15816834|15837318|—|5|circRNA|FAM188A|ENST00000477891.1|9,8,7,6,5

FAM188A

Open Reading Frame (ORF)

LKSPKFPIWIVGSETHLTVFFAKKKIVQKFTRIKRCCLGPVFNVGK

Peptide

FPIWIVGSETHLTVFFAKK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page