top of page

CircRNA

Gene

chr10|15103304|15103713|+|1|circRNA|RPP38|ENST00000378201.6|3

RPP38

CircRNA UID

circRPP38(3)

Open Reading Frame (ORF)

MLSSKCQGGRLHTSGSSLPLALTKLPEPWKGGNCC

Peptide

LHTSGSSLPLALTK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page