top of page

CircRNA

Gene

chr10|13443431|13447265|-|1|ciRNA|BEND7|ENST00000486542.5|3

BEND7

Open Reading Frame (ORF)

MARKATFAGIGWACASELQSFRATGKFSRVRDTLLSLPLSS

Peptide

ATGKFSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page