top of page

CircRNA

Gene

chr10|133398434|133399619|+|3|circRNA|RP11-108K14.8|ENST00000468317.2|5,6,7

RP11-108K14.8

CircRNA UID

circRP11-108K14.8(5,6,7)

Open Reading Frame (ORF)

LEYCIMVIGVPNVGKSSLINSLRRQHLRKENYATLRRRRPKKCHFYQLCKG

Peptide

ENYATLRR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page