top of page

CircRNA

Gene

chr10|124681606|124706887|—|3|circRNA|RP11—12J10.3|ENST00000494792.1|9,8,7

RP11-12J10.3

Open Reading Frame (ORF)

LAISQKGPTPRVSGQWGAVSADINSPGGTHPKSAQVKMADTHPGMEPSA

Peptide

GPTPRVSGQWGAVSADINSPGGTHPK

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page