top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|121538591|121565704|—|4|circRNA|FGFR2|NM_001144914|5,4,3,2

FGFR2

Open Reading Frame (ORF)

MNTGPSITRTTWMLWSHQPNTKSLNQKCTWLRQGSR

Peptide

MNTGPSITR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page