top of page

CircRNA

Gene

chr10|12081471|12094271|+|6|circRNA|DHTKD1|NM_018706|2,3,4,5,6,7

DHTKD1

CircRNA UID

circDHTKD1(2,3,4,5,6,7)

Open Reading Frame (ORF)

LWAVPSSMSMETAQRKWSVPHDWLLNTNASSARM

Peptide

LWAVPSSMSMETAQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page