top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|11979056|12004727|—|5|circRNA|UPF2|ENST00000356352.6|8,7,6,5,4

UPF2

Open Reading Frame (ORF)

LDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHNMGLELIYSHLVNLENMTWKVVYGKMKMLGIFMRTSLI

Peptide

GDFRFHNMGLELIYSHLVNLENMTWK

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

19

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page