top of page

CircRNA

Gene

chr10|11942664|12004727|—|14|circRNA|UPF2|ENST00000356352.6|17,16,15,14,13,12,11,10,9,8,7,6,5,4

UPF2

Open Reading Frame (ORF)

MIKGGGLKHVPCVEDEDFIQALDKMMLENLQNMGLELIYSHLVNLENMTWKVVYGKMKMLGIFMRTSLI

Peptide

MLGIFMR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page