top of page

CircRNA

Gene

chr10|119065398|119073937|-|6|circRNA|EIF3A|ENST00000369144.7|7,6,5,4,3,2

EIF3A

CircRNA UID

circEIF3A(7,6,5,4,3,2)

Open Reading Frame (ORF)

MSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMNFLRLAKSSLLWMFFMML

Peptide

IGLINDMNFLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page