top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|110780800|110784889|+|4|circRNA|RBM20|ENST00000369519.3|2,3,4,5

RBM20

Open Reading Frame (ORF)

MKGTTATQGRMVKLPFPKIFTDPTPKVHMWPADFQLSRLGA

Peptide

GTTATQGRMVK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page