top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|110584182|110598290|+|8|circRNA|SMC3|NM_005445|13,14,15,16,17,18,19,20

SMC3

Open Reading Frame (ORF)

LMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKIGSSYPGKNGSLCKAGSRKPVYIKRRKG

Peptide

IGSSYPGK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page