top of page

CircRNA

Gene

chr10|110130486|110132304|+|1|ciRNA|ADD3|ENST00000360162.7|13

ADD3

Open Reading Frame (ORF)

LMYALTSLKSYAALFCFAWLLTKLLSNRLVNLYIQPRVSHTDNNKVPHVG

Peptide

LVNLYIQPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page