top of page

CircRNA

Gene

chr10|1072115|1093496|+|7|circRNA|WDR37|ENST00000358220.5|2,3,4,5,6,7,8

WDR37

CircRNA UID

circWDR37(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

LLIAGVTRTLPPRSNAHRKRKLFDCSPNKTEAQIP

Peptide

LLIAGVTR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page