top of page

CircRNA

Gene

chr10|1072115|1080476|+|4|circRNA|WDR37|ENST00000358220.5|2,3,4,5

WDR37

Open Reading Frame (ORF)

LKTTYKASTSKLIAGVTRTLPPRSNAHRKRKLFDCSPNKTEAQIP

Peptide

LIAGVTR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page