top of page

CircRNA

Gene

chr10|102146671|102149329|+|5|circRNA|PPRC1|NM_001288728|9,10,11,12,13

PPRC1

Open Reading Frame (ORF)

MLRRHLQPLRVATSCGRQMSSPLISALGAEGSSARGAILILGSPLQLPLPTSYGSPWLLSHCWPKPNLLSPPPRREP

Peptide

QMSSPLISALGAEGSSAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page