top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|9931890|9936627|—|5|circRNA|LZIC|NM_001316975|7,6,5,4,3

LZIC

Open Reading Frame (ORF)

LQMMRPSCQQMQVLYSASLRKSLQTLRLKWLPEERQRQAN

Peptide

LQMMRPSCQQMQVLYSASLRK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page