top of page

CircRNA

Gene

chr1|97679094|97699547|-|3|circRNA|DPYD|ENST00000370192.7|8,7,6

DPYD

CircRNA UID

circDPYD(8,7,6)

Open Reading Frame (ORF)

MTLSTLKEKGYKAAFIGIGIQSNEYPTDQKSFAASPRKNV

Peptide

SFAASPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page