top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|9553625|9580234|+|5|circRNA|SLC25A33|NM_032315|2,3,4,5,6

SLC25A33

Open Reading Frame (ORF)

MNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHGVEAQLVLFSLVH

Peptide

GCASCIAYPHGVEAQLVLFSLVH

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

12

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page