top of page

CircRNA

Gene

chr1|94824492|94845464|+|7|circRNA|SLC44A3|ENST00000446120.6|2,3,4,5,6,7,8

SLC44A3

CircRNA UID

circSLC44A3(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

LGPLGGCAAEPGNCRCLSWATRWWLEPREDSSLAMTALATCVARRTPPWKGPLFQGRT

Peptide

EDSSLAMTALATCVAR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page