top of page

CircRNA

Gene

chr1|946569|948130|-|1|ciRNA|NOC2L|NM_015658|14

NOC2L

CircRNA UID

ciNOC2L(14)

Open Reading Frame (ORF)

MHRAGTPFLGGTHSRGHSLCSSHVLLGGDTWHWGISASGLKGPGSGSGVGVRKCFW

Peptide

GPGSGSGVGVR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page