top of page

CircRNA

Gene

chr1|94498601|94499614|+|4|circRNA|ABCD3|NM_002858|17,18,19,20

ABCD3

CircRNA UID

circABCD3(17,18,19,20)

Open Reading Frame (ORF)

MSSWVISLNVKEAGTVFRIGWTYSVVEKSKEWRFDLGLMF

Peptide

EAGTVFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page