top of page

CircRNA

Gene

chr1|94184871|94203994|-|11|circRNA|ARHGAP29|ENST00000552844.5|18,17,16,15,14,13,12,11,10,9,8

ARHGAP29

CircRNA UID

circARHGAP29(18,17,16,15,14,13,12,11,10,9,8)

Open Reading Frame (ORF)

LSSKVFGKFSHYLWSSETSRKNTLIWSRIHTSCKKGTRWYPFYTQNMCLRD

Peptide

FSHYLWSSETSR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page