top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|94184871|94203994|—|11|circRNA|ARHGAP29|ENST00000552844.5|18,17,16,15,14,13,12,11,10,9,8

ARHGAP29

Open Reading Frame (ORF)

LEQNSHKLQKRNQMVSLLYSKYVPQRLKIELCVYRIGVH

Peptide

RNQMVSLLYSK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page