top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|9355742|9356585|+|1|circRNA|SPSB1|ENST00000328089.10|2

SPSB1

Open Reading Frame (ORF)

MEQQRPIAQCLCEGGRQAHLSPASGGPEHGRYQGQSRVYPWAARVADHVGHETAGHTRRGGGGDGRRPPALCRVHNPRGE

Peptide

GGGGDGRRPPALCR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page