top of page

CircRNA

Gene

chr1|93183359|93216746|+|12|circRNA|CCDC18|ENST00000343253.11|2,3,4,5,6,7,8,9,10,11,12,13

CCDC18

CircRNA UID

circCCDC18(2,3,4,5,6,7,8,9,10,11,12,13)

Open Reading Frame (ORF)

MTKKCSQLLTLEKQLEEKIVAYSSIAAKNAELEQELMKWNLVHQTTIIKTMKRKVCLQMLLP

Peptide

IVAYSSIAAKNAELEQELMK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page