top of page

CircRNA

Gene

chr1|85164525|85190752|-|5|circRNA|SYDE2|ENST00000341460.5|6,5,4,3,2

SYDE2

CircRNA UID

circSYDE2(6,5,4,3,2)

Open Reading Frame (ORF)

LIQKNLQVLWILKNTLKFFITYSNSGQIYLKMPMGLQ

Peptide

FFITYSNSGQIYLK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page