top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|84563256|84570720|—|5|circRNA|CTBS|ENST00000370630.5|6,5,4,3,2

CTBS

Open Reading Frame (ORF)

LETYGIKISGLLIITIKSLCLMLDRKLGNLMIGHRLQLWQHLENMTQNLCATLIQKEPE

Peptide

LGNLMIGHRLQLWQHLENMTQNLCATLIQK

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page