top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|83890320|83911363|—|5|circRNA|TTLL7|ENST00000472688.5|16,15,14,13,12

TTLL7

Open Reading Frame (ORF)

MIVAAALQNLTKMKKKSTKIRKEKSKLHIILNPPTTTN

Peptide

LHIILNPPTTTN

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page