top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|81836884|81907230|+|2|circRNA|ADGRL2|ENST00000370721.5|5,6

ADGRL2

Open Reading Frame (ORF)

LRALTMVGRMTRFVMLTHFRWRIQTATSPMPSKL

Peptide

IQTATSPMPSK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page