top of page

CircRNA

Gene

chr1|7835761|7837149|+|2|circRNA|PER3|ENST00000613533.4|20,21

PER3

CircRNA UID

circPER3(20,21)

Open Reading Frame (ORF)

LEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQEAATAVYTLLVVFILLKSPKMGSNLRTYRKKKHFLMSPKSPSGE

Peptide

SPKMGSNLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page