top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|77717866|77728712|—|8|circRNA|USP33|ENST00000370794.7|17,16,15,14,13,12,11,10

USP33

Open Reading Frame (ORF)

LCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASRCSRIPSMFNGFAS

Peptide

DSPAQIVTYDLLSVICHHGTASR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page