top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|75238512|75243011|—|3|circRNA|SLC44A5|NM_001130058|10,9,8

SLC44A5

Open Reading Frame (ORF)

LLQNLCLQVPRKIFNLCGNATFVHKRQKLLGRLPSVL

Peptide

KIFNLCGNATFVHK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page