top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|70417936|70424416|+|3|circRNA|CTH|NM_001902|3,4,5

CTH

Open Reading Frame (ORF)

LTLKAVHILSISMETLFWSWITLLCHHISRFGLCFRFSSHCNYYPSFKSRRPNYLYG

Peptide

AVHILSISMETLFWSWITLLCHHISRFGLCFR

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page